SAP ABAP Table Field VIRAADVPAYSPLIT-RESTCTFCNETAMT (Net Amount of Advance Payment in Foreign Currency)
Hierarchy
EA-FIN (Software Component) EA-FIN
   RE-FX-RA (Application Component) Rental Accounting
     RE_RA_AP (Package) RE: Advance Payment
Basic Data
Table VIRAADVPAYSPLIT     Split Advance Payments
Field RESTCTFCNETAMT     Net Amount of Advance Payment in Foreign Currency
Position 47    
Field Attributes
Key    
Mandatory    
Data Element RERAAPCTFCNETAMOUNT     Net Amount of Advance Payment in Foreign Currency
Check Table      
Nesting depth for includes 1    
Internal ABAP Type P     Packed number
Internal Length in Bytes 8    
Reference table VIRAADVPAYSPLIT     Split Advance Payments
Name of Include      
Reference Field (CURR or QTY) CTFCCURRKEY    
Check module    
NOT NULL forced       Any NULL or NOT NULL
Data Type in ABAP Dictionary CURR     Currency field, stored as DEC
Length (No. of Characters) 15    
Number of Decimal Places 2    
Domain name RECACURR     Value field PL8 with +/- sign
Origin of an input help (F4)       No input help exists
DD: Flag if it is a table       No / FALSE
DD: Depth for structured types 0    
DD: Component Type E     Data element
Type of Object Referenced       No Information
DD: Indicator for a Language Field       Not selected as language field
Position of the field in the table 0    
History
Last changed by/on SAP  20110901 
SAP Release Created in 600