SAP ABAP Table Field VIRAADVPAYSPLIT-RESTCTFCNETAMT (Net Amount of Advance Payment in Foreign Currency)
Hierarchy
☛
EA-FIN (Software Component) EA-FIN
⤷
RE-FX-RA (Application Component) Rental Accounting
⤷
RE_RA_AP (Package) RE: Advance Payment

⤷

⤷

Basic Data
Table | VIRAADVPAYSPLIT | Split Advance Payments |
Field | RESTCTFCNETAMT | Net Amount of Advance Payment in Foreign Currency |
Position | 47 |
Field Attributes
Key | ||
Mandatory | ||
Data Element | RERAAPCTFCNETAMOUNT | Net Amount of Advance Payment in Foreign Currency |
Check Table | ||
Nesting depth for includes | 1 | |
Internal ABAP Type | P | Packed number |
Internal Length in Bytes | 8 | |
Reference table | VIRAADVPAYSPLIT | Split Advance Payments |
Name of Include | ||
Reference Field (CURR or QTY) | CTFCCURRKEY | |
Check module | ||
NOT NULL forced | Any NULL or NOT NULL | |
Data Type in ABAP Dictionary | CURR | Currency field, stored as DEC |
Length (No. of Characters) | 15 | |
Number of Decimal Places | 2 | |
Domain name | RECACURR | Value field PL8 with +/- sign |
Origin of an input help (F4) | No input help exists | |
DD: Flag if it is a table | No / FALSE | |
DD: Depth for structured types | 0 | |
DD: Component Type | E | Data element |
Type of Object Referenced | No Information | |
DD: Indicator for a Language Field | Not selected as language field | |
Position of the field in the table | 0 |
History
Last changed by/on | SAP | 20110901 |
SAP Release Created in | 600 |