SAP ABAP Table Field RERAADVPAYSPLIT-RESTCTFCNETAMT (Net Amount of Advance Payment in Foreign Currency)
Hierarchy
☛
EA-FIN (Software Component) EA-FIN
⤷
RE-FX-RA (Application Component) Rental Accounting
⤷
RE_RA_AP (Package) RE: Advance Payment
⤷
⤷
Basic Data
| Table | RERAADVPAYSPLIT | Split Advance Payments |
| Field | RESTCTFCNETAMT | Net Amount of Advance Payment in Foreign Currency |
| Position | 48 |
Field Attributes
| Key | ||
| Mandatory | ||
| Data Element | RERAAPCTFCNETAMOUNT | Net Amount of Advance Payment in Foreign Currency |
| Check Table | ||
| Nesting depth for includes | 2 | |
| Internal ABAP Type | P | Packed number |
| Internal Length in Bytes | 8 | |
| Reference table | RERAADVPAYSPLIT | Split Advance Payments |
| Name of Include | ||
| Reference Field (CURR or QTY) | CTFCCURRKEY | |
| Check module | ||
| NOT NULL forced | Any NULL or NOT NULL | |
| Data Type in ABAP Dictionary | CURR | Currency field, stored as DEC |
| Length (No. of Characters) | 15 | |
| Number of Decimal Places | 2 | |
| Domain name | RECACURR | Value field PL8 with +/- sign |
| Origin of an input help (F4) | No input help exists | |
| DD: Flag if it is a table | No / FALSE | |
| DD: Depth for structured types | 0 | |
| DD: Component Type | E | Data element |
| Type of Object Referenced | No Information | |
| DD: Indicator for a Language Field | Not selected as language field | |
| Position of the field in the table | 0 |
History
| Last changed by/on | SAP | 20110901 |
| SAP Release Created in | 600 |