SAP ABAP Table Field SQLMDATASELECTFILTERSTMTKIND-SYSTEM
Hierarchy
☛
SAP_BASIS (Software Component) SAP Basis Component
⤷
BC-DWB-TOO-RTA (Application Component) Runtime Analysis
⤷
SQLM_CORE (Package) SQL Monitor Core
⤷
⤷
Basic Data
| Table | SQLMDATASELECTFILTERSTMTKIND | SQL Monitor: SELECT Filter Statement Kind |
| Field | SYSTEM | |
| Position | 4 |
Field Attributes
| Key | ||
| Mandatory | ||
| Data Element | ||
| Check Table | ||
| Nesting depth for includes | 0 | |
| Internal ABAP Type | C | Character String |
| Internal Length in Bytes | 1 | |
| Reference table | ||
| Name of Include | ||
| Reference Field (CURR or QTY) | ||
| Check module | ||
| NOT NULL forced | Any NULL or NOT NULL | |
| Data Type in ABAP Dictionary | CHAR | Character String |
| Length (No. of Characters) | 1 | |
| Number of Decimal Places | 0 | |
| Domain name | ||
| Origin of an input help (F4) | No input help exists | |
| DD: Flag if it is a table | No / FALSE | |
| DD: Depth for structured types | 0 | |
| DD: Component Type | Built-in type | |
| Type of Object Referenced | No Information | |
| DD: Indicator for a Language Field | Not selected as language field | |
| Position of the field in the table | 0 |
History
| Last changed by/on | SAP | 20140117 |
| SAP Release Created in | 740 |