SAP ABAP Table Field RJKSDMSDDELIVERYASSIGN-NACHLFNGNR (Sequence number of subsequent delivery)
Hierarchy
IS-M (Software Component) SAP MEDIA
   IS-M (Application Component) SAP Media
     JSDI (Package) IS-M/SD SD Integration
Basic Data
Table RJKSDMSDDELIVERYASSIGN     IS-M: Delivery to Be Updated
Field NACHLFNGNR     Sequence number of subsequent delivery
Position 4    
Field Attributes
Key    
Mandatory    
Data Element NACHLFNGNR     Sequence number of subsequent delivery
Check Table      
Nesting depth for includes 0    
Internal ABAP Type N     Character String with Digits Only
Internal Length in Bytes 2    
Reference table      
Name of Include      
Reference Field (CURR or QTY)      
Check module    
NOT NULL forced       Any NULL or NOT NULL
Data Type in ABAP Dictionary NUMC     Character string with only digits
Length (No. of Characters) 2    
Number of Decimal Places 0    
Domain name NUM2     Two-digit numeric value
Origin of an input help (F4)       No input help exists
DD: Flag if it is a table       No / FALSE
DD: Depth for structured types 0    
DD: Component Type E     Data element
Type of Object Referenced       No Information
DD: Indicator for a Language Field       Not selected as language field
Position of the field in the table 0    
History
Last changed by/on SAP  20050224 
SAP Release Created in