SAP ABAP Table Field RJKSDMSDDELIVERYASSIGN-NACHLFNGNR (Sequence number of subsequent delivery)
Hierarchy
☛
IS-M (Software Component) SAP MEDIA
⤷
IS-M (Application Component) SAP Media
⤷
JSDI (Package) IS-M/SD SD Integration

⤷

⤷

Basic Data
Table | RJKSDMSDDELIVERYASSIGN | IS-M: Delivery to Be Updated |
Field | NACHLFNGNR | Sequence number of subsequent delivery |
Position | 4 |
Field Attributes
Key | ||
Mandatory | ||
Data Element | NACHLFNGNR | Sequence number of subsequent delivery |
Check Table | ||
Nesting depth for includes | 0 | |
Internal ABAP Type | N | Character String with Digits Only |
Internal Length in Bytes | 2 | |
Reference table | ||
Name of Include | ||
Reference Field (CURR or QTY) | ||
Check module | ||
NOT NULL forced | Any NULL or NOT NULL | |
Data Type in ABAP Dictionary | NUMC | Character string with only digits |
Length (No. of Characters) | 2 | |
Number of Decimal Places | 0 | |
Domain name | NUM2 | Two-digit numeric value |
Origin of an input help (F4) | No input help exists | |
DD: Flag if it is a table | No / FALSE | |
DD: Depth for structured types | 0 | |
DD: Component Type | E | Data element |
Type of Object Referenced | No Information | |
DD: Indicator for a Language Field | Not selected as language field | |
Position of the field in the table | 0 |
History
Last changed by/on | SAP | 20050224 |
SAP Release Created in |