SAP ABAP Table Field RJKSDMSDDELIVERYASSIGN-NACHLFNGNR (Sequence number of subsequent delivery)
Hierarchy
☛
IS-M (Software Component) SAP MEDIA
⤷
IS-M (Application Component) SAP Media
⤷
JSDI (Package) IS-M/SD SD Integration
⤷
⤷
Basic Data
| Table | RJKSDMSDDELIVERYASSIGN | IS-M: Delivery to Be Updated |
| Field | NACHLFNGNR | Sequence number of subsequent delivery |
| Position | 4 |
Field Attributes
| Key | ||
| Mandatory | ||
| Data Element | NACHLFNGNR | Sequence number of subsequent delivery |
| Check Table | ||
| Nesting depth for includes | 0 | |
| Internal ABAP Type | N | Character String with Digits Only |
| Internal Length in Bytes | 2 | |
| Reference table | ||
| Name of Include | ||
| Reference Field (CURR or QTY) | ||
| Check module | ||
| NOT NULL forced | Any NULL or NOT NULL | |
| Data Type in ABAP Dictionary | NUMC | Character string with only digits |
| Length (No. of Characters) | 2 | |
| Number of Decimal Places | 0 | |
| Domain name | NUM2 | Two-digit numeric value |
| Origin of an input help (F4) | No input help exists | |
| DD: Flag if it is a table | No / FALSE | |
| DD: Depth for structured types | 0 | |
| DD: Component Type | E | Data element |
| Type of Object Referenced | No Information | |
| DD: Indicator for a Language Field | Not selected as language field | |
| Position of the field in the table | 0 |
History
| Last changed by/on | SAP | 20050224 |
| SAP Release Created in |