SAP ABAP Table Field EIDESWTMSGFIELD-FIELDCHECKTYPE (Type of Field Check)
Hierarchy
☛
IS-UT (Software Component) SAP Utilities/Telecommunication
⤷ IS-U-IDE (Application Component) Intercompany Data Exchange
⤷ EE_IDE_SWITCH (Package) IDE Change of Supplier and Service
⤷ IS-U-IDE (Application Component) Intercompany Data Exchange
⤷ EE_IDE_SWITCH (Package) IDE Change of Supplier and Service
Basic Data
Table | EIDESWTMSGFIELD | Field Configuration for Message Data Check |
Field | FIELDCHECKTYPE | Type of Field Check |
Position | 5 |
Field Attributes
Key | ||
Mandatory | ||
Data Element | EIDESWTFIELDCHECKTYPE | Type of Field Check |
Check Table | ||
Nesting depth for includes | 0 | |
Internal ABAP Type | N | Character String with Digits Only |
Internal Length in Bytes | 1 | |
Reference table | ||
Name of Include | ||
Reference Field (CURR or QTY) | ||
Check module | ||
NOT NULL forced | Any NULL or NOT NULL | |
Data Type in ABAP Dictionary | NUMC | Character string with only digits |
Length (No. of Characters) | 1 | |
Number of Decimal Places | 0 | |
Domain name | EIDESWTFIELDCHECKTYPE | Type of Field Check |
Origin of an input help (F4) | F | Input help with fixed values |
DD: Flag if it is a table | No / FALSE | |
DD: Depth for structured types | 0 | |
DD: Component Type | E | Data element |
Type of Object Referenced | No Information | |
DD: Indicator for a Language Field | Not selected as language field | |
Position of the field in the table | 0 |
History
Last changed by/on | SAP | 20130529 |
SAP Release Created in | 472 |