SAP ABAP Table Field BCTCO_MAPASSTMTSLAYTELMTREQMSG-REFERENCE_ID
Hierarchy
☛
BI_CONT (Software Component) Business Intelligence Content
⤷
CA (Application Component) Cross-Application Components
⤷
BI_CONT_CO_XI_PROXY (Package) XI-objects for BI_CONT: ONLY(!) for Datatype-Proxies
⤷
⤷
Basic Data
| Table | BCTCO_MAPASSTMTSLAYTELMTREQMSG | Merchandise And Assortment Planning Assortment ERP Store Lay |
| Field | REFERENCE_ID | |
| Position | 15 |
Field Attributes
| Key | ||
| Mandatory | ||
| Data Element | BCTCO_BUS_DOC_MSG_ID | |
| Check Table | ||
| Nesting depth for includes | 0 | |
| Internal ABAP Type | ||
| Internal Length in Bytes | 0 | |
| Reference table | ||
| Name of Include | ||
| Reference Field (CURR or QTY) | ||
| Check module | ||
| NOT NULL forced | Any NULL or NOT NULL | |
| Data Type in ABAP Dictionary | STRU | |
| Length (No. of Characters) | 0 | |
| Number of Decimal Places | 0 | |
| Domain name | ||
| Origin of an input help (F4) | No input help exists | |
| DD: Flag if it is a table | No / FALSE | |
| DD: Depth for structured types | 1 | |
| DD: Component Type | S | Structured type (possibly as INCLUDE) |
| Type of Object Referenced | No Information | |
| DD: Indicator for a Language Field | Not selected as language field | |
| Position of the field in the table | 0 |
History
| Last changed by/on | SAP | 20141031 |
| SAP Release Created in | 703 |