SAP ABAP Table Field BCTCO_MAPASSTMTSLAYTELMTREQMSG-REFERENCE_ID
Hierarchy
☛
BI_CONT (Software Component) Business Intelligence Content
⤷
CA (Application Component) Cross-Application Components
⤷
BI_CONT_CO_XI_PROXY (Package) XI-objects for BI_CONT: ONLY(!) for Datatype-Proxies

⤷

⤷

Basic Data
Table | BCTCO_MAPASSTMTSLAYTELMTREQMSG | Merchandise And Assortment Planning Assortment ERP Store Lay |
Field | REFERENCE_ID | |
Position | 15 |
Field Attributes
Key | ||
Mandatory | ||
Data Element | BCTCO_BUS_DOC_MSG_ID | |
Check Table | ||
Nesting depth for includes | 0 | |
Internal ABAP Type | ||
Internal Length in Bytes | 0 | |
Reference table | ||
Name of Include | ||
Reference Field (CURR or QTY) | ||
Check module | ||
NOT NULL forced | Any NULL or NOT NULL | |
Data Type in ABAP Dictionary | STRU | |
Length (No. of Characters) | 0 | |
Number of Decimal Places | 0 | |
Domain name | ||
Origin of an input help (F4) | No input help exists | |
DD: Flag if it is a table | No / FALSE | |
DD: Depth for structured types | 1 | |
DD: Component Type | S | Structured type (possibly as INCLUDE) |
Type of Object Referenced | No Information | |
DD: Indicator for a Language Field | Not selected as language field | |
Position of the field in the table | 0 |
History
Last changed by/on | SAP | 20141031 |
SAP Release Created in | 703 |